產(chǎn)品詳情
Edit   Antigenic Specificity ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Clone polyclonal Host Species Mouse Reactive Species human Isotype n/a Format Protein G purified, no preservative Size 50 ug Concentration n/a Applications Western Blot. It has been used for WB. Reviews / Ratings If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY . Description The ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody from Novus Biologicals is a mouse polyclonal antibody to ST6 Gal Sialyltransferase 1/ST6GAL1/CD75. This antibody reacts with human. The ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody has been validated for the following applications: Western Blot. Immunogen ST6GAL1 (NP_775324.1, 1 a.a. - 175 a.a.) full-length human protein. MNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC Other Names B-cell antigen CD75, beta-galactoside alpha-2,6-sialyltransferase 1, CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1, EC 2.4.99.1, MGC48859, Sialyltransferase 1, sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase), sialyltransferase 1 (beta-galactoside alpha-2,6-sialytransferase), SIAT1Alpha 2,6-ST 1, ST6 beta-galactosamide alpha-2,6-sialyltranferase 1, ST6Gal I, ST6GalI, ST6N Gene, Accession # ST6GAL1, Gene ID: 6480, Accession: NP_775324.1, SwissProt: NP_775324.1 Catalog # H00006480-B01P Price Order / More Info ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody from NOVUS BIOLOGICALS, LLC Product Specific References n/a
產(chǎn)品資料
<![CDATA[<strong id="itm00"><address id="itm00"></address></strong>]]>
<![CDATA[<th id="itm00"></th>]]> <![CDATA[<acronym id="itm00"><label id="itm00"></label></acronym>]]>
<![CDATA[<th id="itm00"></th>]]>