| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ATPase Na+/K+ beta 3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ATPase Na+/K+ beta 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATPase Na+/K+ beta 3. This antibody reacts with human. The ATPase Na+/K+ beta 3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ATPase Na+/K+ beta 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCIL |
| Other Names | ATPase, Na+/K+ transporting, beta 3 polypeptide, ATPB-3, CD298, CD298 antigen, FLJ29027, Na, K-ATPase beta-3 polypeptide, sodium/potassium-dependent ATPase beta-3 subunit, Sodium/potassium-dependent ATPase subunit beta-3, sodium/potassium-transporting ATPase beta-3 chain, sodium/potassium-transporting ATPase subunit beta-3 |
| Gene, Accession # | ATP1B3, Gene ID: 483, Accession: P54709, SwissProt: P54709 |
| Catalog # | NBP2-38595 |
| Price | |
| Order / More Info | ATPase Na+/K+ beta 3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|