Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The Staufen Antibody from Novus Biologicals is a rabbit polyclonal antibody to Staufen. This antibody reacts with human. The Staufen Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Immunogen
Synthetic peptides corresponding to STAU1(staufen, RNA binding protein, homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of STAU1. Peptide sequence SQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPI.
Other Names
double-stranded RNA-binding protein Staufen homolog 1, FLJ25010, RNA binding protein (Drosophila), RNA-binding protein), staufen, RNA binding protein, homolog 1 (Drosophila)