Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The SerpinB9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SerpinB9. This antibody reacts with human. The SerpinB9 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SerpinB9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLV
Other Names
CAP-3, CAP3PI-9, Cytoplasmic antiproteinase 3, Peptidase inhibitor 9, PI9protease inhibitor 9 (ovalbumin type), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9, serpin B9, serpin peptidase inhibitor, clade B (ovalbumin), member 9, serpin peptidase inhibitor, clade B, member 9