| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Cytosolic Sulfotransferase 1E1/SULT1E1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytosolic Sulfotransferase 1E1/SULT1E1. This antibody reacts with human. The Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to SULT1E1 (sulfotransferase family 1E, estrogen-preferring, member 1) The peptide sequence was selected from the middle region of SULT1E1. Peptide sequence LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLF |
| Other Names | EC 2.8.2, EST-1, ESTMGC34459, estrone sulfotransferase, ST1E1, STEestrogen sulfotransferase, Sulfotransferase 1E1, sulfotransferase family 1E, estrogen-preferring, member 1, Sulfotransferase, estrogen-preferringEC 2.8.2.4 |
| Gene, Accession # | SULT1E1, Gene ID: 6783, Accession: P49888, SwissProt: P49888 |
| Catalog # | NBP1-56977 |
| Price | |
| Order / More Info | Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23476785, 23520248 |
| 產(chǎn)品資料 |
|
|