| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | P2Y12/P2RY12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, canine, feline |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity per customer review. IHC-F reactivity per customer review. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The P2Y12/P2RY12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to P2Y12/P2RY12. This antibody reacts with human, canine, feline. The P2Y12/P2RY12 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
| Other Names | ADPG-R, Gi-coupled ADP receptor HORK3, HORK3P2Y12 platelet ADP receptor, P2T(AC), P2Y purinoceptor 12, P2Y(AC), P2Y(ADP), P2Y(cyc), P2Y12ADP-glucose receptor, purinergic receptor P2RY12, purinergic receptor P2Y, G-protein coupled, 12, putative G-protein coupled receptor, SP1999G-protein coupled receptor SP1999 |
| Gene, Accession # | P2RY12, Gene ID: 64805, Accession: Q9H244, SwissProt: Q9H244 |
| Catalog # | NBP2-33870-25ul |
| Price | |
| Order / More Info | P2Y12/P2RY12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 30462183 |
| 產(chǎn)品資料 |
|
|