If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The AKAP10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKAP10. This antibody reacts with human. The AKAP10 Antibody has been validated for the following applications: Western Blot.
Immunogen
Synthetic peptide directed towards the middle region of human AKAP10 (NP_009133). Peptide sequence ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ.
Other Names
A kinase (PRKA) anchor protein 10, AKAP-10, A-kinase anchor protein 10, mitochondrial, D-AKAP2, D-AKAP-2, Dual specificity A kinase-anchoring protein 2, dual-specificity A-kinase anchoring protein 2, MGC9414, mitochondrial A kinase PPKA anchor protein 10, PRKA10a kinase anchor protein 10, mitochondrial, protein kinase A anchoring protein 10, Protein kinase A-anchoring protein 10