| Edit |   |
| Antigenic Specificity | Bol, Boule-Like (Drosophila) (BOLL) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | This gene belongs to the DAZ gene family required for germ cell development. BOLL is an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition. |
| Immunogen | BOLL antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ |
| Other Names | BOULE|4930554P13Rik|4930597B14Rik|RGD1559527 |
| Gene, Accession # | Gene ID: 66037 |
| Catalog # | ABIN633322 |
| Price | |
| Order / More Info | Bol, Boule-Like (Drosophila) (BOLL) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |