| Edit |   |
| Antigenic Specificity | ARL11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 82%, rat 82%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human ARL11 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGV |
| Other Names | ADP-ribosylation factor-like 11, ARLTS1, FLJ33930 |
| Gene, Accession # | Gene ID: 115761, UniProt: Q969Q4, ENSG00000152213 |
| Catalog # | HPA040887 |
| Price | |
| Order / More Info | ARL11 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |