| Edit |   |
| Antigenic Specificity | Destrin (Actin Depolymerizing Factor) (DSTN) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DSTN belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. It is the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). |
| Immunogen | Destrin antibody was raised using a synthetic peptide corresponding to a region with amino acids ASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEE |
| Other Names | Dstn|DSTN|adf|actdp|ba462d18.2|LOC100190417|2610043P17Rik|ADF|AU042046|Dsn|corn1|sid23p|ACTDP|bA462D18.2|destrin |
| Gene, Accession # | Gene ID: 11034,56431,502674 |
| Catalog # | ABIN632457 |
| Price | |
| Order / More Info | Destrin (Actin Depolymerizing Factor) (DSTN) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |