| Edit |   |
| Antigenic Specificity | GMPR2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 88%, rat 90%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human GMPR2 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYIC |
| Other Names | guanosine monophosphate reductase 2 |
| Gene, Accession # | Gene ID: 51292, UniProt: Q9P2T1, ENSG00000100938 |
| Catalog # | HPA068782 |
| Price | |
| Order / More Info | GMPR2 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |