| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | SPARC |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (predicted: bovine) |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for SPARC(SPARC) detection. Tested with WB in Human. No cross reactivity with other proteins. SPARC, secreted protein acidic and rich in cysteine , also known as Osteonectin is a protein that in humans is encoded by the SPARC gene. The human SPARC gene is 26.5 kb long, and contains 10 exons and 9 introns and is located on chromosome 5q31-q33. SPARC is a glycoprotein of 40 kD. SPARC is an acidic, cysteine-rich glycoprotein consisting of a single polypeptide chain that can be broken into 4 domains: 1) an Ca++ binding domains near the glutamic acidic-rich region at the amino terminus (domain I), 2) a cysteine- rich (domain II), 3) a hydrophilic region (domain III) and 4) an EF hand motif at the carboxy terminus region (domain IV). Osteonectin is a glycoprotein in the bone that binds sodium. It is secreted by osteoblasts during bone formation, initiating mineralization and promoting mineral crystal formation. Osteonectin also shows affinity for collagen in addition to bone mineral calcium. A correlation between osteonectin over expression and ampullary cancers and chronic pancreatitis has been found. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human SPARC (268-303aa RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI), different from the related mouse and rat sequences by four amino acids. |
| Other Names | SPARC;Basement-membrane protein 40;BM-40;Osteonectin;ON;Secreted protein acidic and rich in cysteine;SPARC;ON; |
| Gene, Accession # | SPARC, UniProt: P09486 |
| Catalog # | PB9559 |
| Price | |
| Order / More Info | SPARC Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|