| Edit |   |
| Antigenic Specificity | LYZL6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 77%, rat 77%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human LYZL6 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHY |
| Other Names | lysozyme-like 6, LYC1, PRO1485, TKAL754 |
| Gene, Accession # | Gene ID: 57151, UniProt: O75951, ENSG00000275722 |
| Catalog # | HPA053073 |
| Price | |
| Order / More Info | LYZL6 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |