| Edit |   |
| Antigenic Specificity | Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, dog |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells. |
| Immunogen | PABPC4 antibody was raised using the N terminal of PABPC4 corresponding to a region with amino acids AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS |
| Other Names | cb12|sb:cb12|PABP|ePAB|ePABP|APP-1|APP1|PABP4|iPABP |
| Gene, Accession # | Gene ID: 8761,482464 |
| Catalog # | ABIN629988 |
| Price | |
| Order / More Info | Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form) (PABPC4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |