| Edit |   |
| Antigenic Specificity | Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of PARP12 protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL |
| Other Names | PARP12|zc3h1|mst109|mstp109|zc3hdc1|si:ch211-227d19.2|ARTD12|MST109|MSTP109|ZC3H1|ZC3HDC1|9930021O16|AA409132|AA536654|PARP-12|Zc3hdc1 |
| Gene, Accession # | Gene ID: 64761 |
| Catalog # | ABIN631944 |
| Price | |
| Order / More Info | Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |