| Edit |   |
| Antigenic Specificity | EF-Hand Domain Family, Member D2 (EFHD2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | EFHD2 may regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. It plays a role as negative regulator of the canonical NF-kappa-B-activating branch. EFHD2 controls spontaneous apoptosis through the regulation of BCL2L1 abundance. |
| Immunogen | EFHD2 antibody was raised using the N terminal of EFHD2 corresponding to a region with amino acids MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG |
| Other Names | efhd2|EFHD2|MGC131292|si:dkey-72l14.9|wu:fb80e07|2600015J22Rik|AA408606|D4Wsu27e|fj19b07|si:ch211-281l24.1|wu:fj19b07|SWS1 |
| Gene, Accession # | Gene ID: 79180 |
| Catalog # | ABIN631302 |
| Price | |
| Order / More Info | EF-Hand Domain Family, Member D2 (EFHD2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |