| Edit |   |
| Antigenic Specificity | Chromosome 4 Open Reading Frame 20 (C4orf20) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Ubiquitin-fold modifier-1 must be processed by a protease before it can conjugate with its target proteins. C4ORF20 is a thiol protease that specifically processes the C terminus of UFM1. |
| Immunogen | C4 ORF20 antibody was raised using the middle region of C4 rf20 corresponding to a region with amino acids YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD |
| Other Names | C4orf20|1810047C23Rik|RGD1311161|cb891|fb05c06|fk89d04|wu:fb05c06|wu:fk89d04|zgc:64113 |
| Gene, Accession # | Gene ID: 55325 |
| Catalog # | ABIN632946 |
| Price | |
| Order / More Info | Chromosome 4 Open Reading Frame 20 (C4orf20) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |