| Edit |   |
| Antigenic Specificity | Chromosome 6 Open Reading Frame 150 (C6orf150) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of C6orf150 protein has not been widely studied, and is yet to be fully elucidated. |
| Immunogen | C6 ORF150 antibody was raised using the middle region of C6 rf150 corresponding to a region with amino acids VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC |
| Other Names | C6orf150|cGAS|h-cGAS |
| Gene, Accession # | Gene ID: 115004 |
| Catalog # | ABIN632718 |
| Price | |
| Order / More Info | Chromosome 6 Open Reading Frame 150 (C6orf150) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |