| Edit |   |
|---|
| Antigenic Specificity | Chromosome 8 Open Reading Frame 45 (C8orf45) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of Chromosome 8 ORF protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | C8 orf45 antibody was raised using the middle region of C8 rf45 corresponding to a region with amino acids IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGE |
|---|
| Other Names | C8orf45|6030422M02Rik |
|---|
| Gene, Accession # | Gene ID: 157777 |
|---|
| Catalog # | ABIN633137 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 8 Open Reading Frame 45 (C8orf45) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|