| Edit |   |
| Antigenic Specificity | Chromosome 1 Open Reading Frame 103 (C1orf103) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | C1 ORF103 antibody was raised using the N terminal Of C1 rf103 corresponding to a region with amino acids KKIFGLTKDLRVCLTRIPDHLTSGEGFDSFSSLVKSGTYKETEFMVKEGE |
| Other Names | C1orf103|RIF1|RP11-96K19.1|2010012G17Rik|4933421E11Rik|AI450568|Rif1|RGD1306520 |
| Gene, Accession # | Gene ID: 55791 |
| Catalog # | ABIN632871 |
| Price | |
| Order / More Info | Chromosome 1 Open Reading Frame 103 (C1orf103) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |