| Edit |   |
| Antigenic Specificity | Chromosome 11 Open Reading Frame 46 (C11orf46) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | C11 ORF46 antibody was raised using the N terminal Of C11 rf46 corresponding to a region with amino acids SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK |
| Other Names | MGC115732|ARF7EP|C11orf46|dJ299F11.1|2700007P21Rik|4930448O08Rik|RGD1311463|C15H11orf46|ARL14EP |
| Gene, Accession # | Gene ID: 120534 |
| Catalog # | ABIN631992 |
| Price | |
| Order / More Info | Chromosome 11 Open Reading Frame 46 (C11orf46) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |