| Edit |   |
|---|
| Antigenic Specificity | Chromosome 14 Open Reading Frame 104 (C14orf104) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This protein is highly conserved and involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene. |
|---|
| Immunogen | C14 ORF104 antibody was raised using the N terminal Of C14 rf104 corresponding to a region with amino acids MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG |
|---|
| Other Names | 1110034A24Rik|2810020C19Rik|AV032410|Ktu|TU54|mknt|C14orf104|CILD10|KTU|PF13|C10H14orf104|RGD1310311|c14orf104|cild10|kintoun|ktu|zgc:110294 |
|---|
| Gene, Accession # | Gene ID: 55172 |
|---|
| Catalog # | ABIN632937 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 14 Open Reading Frame 104 (C14orf104) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|