| Edit |   |
| Antigenic Specificity | Chromosome 14 Open Reading Frame 180 (C14orf180) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known. |
| Immunogen | C14 ORF180 antibody was raised using the N terminal Of C14 rf180 corresponding to a region with amino acids EDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNA |
| Other Names | C14orf77|NRAC |
| Gene, Accession # | Gene ID: 400258 |
| Catalog # | ABIN635016 |
| Price | |
| Order / More Info | Chromosome 14 Open Reading Frame 180 (C14orf180) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |