| Edit |   |
| Antigenic Specificity | Chromosome 14 Open Reading Frame 37 (C14ORF37) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | C14 ORF37 antibody was raised using the N terminal Of C14 rf37 corresponding to a region with amino acids EIAHVHAEKGQSDKMNTDDLENSSVTSKQTPQLVVSEDPMMMSAVPSATS |
| Other Names | c14_5376 |
| Gene, Accession # | Gene ID: 145407 |
| Catalog # | ABIN635213 |
| Price | |
| Order / More Info | Chromosome 14 Open Reading Frame 37 (C14ORF37) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |