| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ARP1 Actin-Related Protein 1 Homolog A, Centractin alpha (Yeast) (ACTR1A) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat, dog |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ACTR1A is a 42.6 kDa subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. |
| Immunogen | ACTR1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP |
| Other Names | ACTR1A|arp1|centractin|ctrn1|ARP1|CTRN1|Arp1|alpha-Arp1 |
| Gene, Accession # | Gene ID: 10121,403791,54130,294010 |
| Catalog # | ABIN630759 |
| Price | |
| Order / More Info | ARP1 Actin-Related Protein 1 Homolog A, Centractin alpha (Yeast) (ACTR1A) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|