| Edit |   |
| Antigenic Specificity | ARP3 Actin-Related Protein 3 Homolog B (Yeast) (ACTR3B) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors. |
| Immunogen | ACTR3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR |
| Other Names | RGD1565759|ARP11|ARP3BETA|9630005C02|AW047569|Arp3b|Arp3beta |
| Gene, Accession # | Gene ID: 57180 |
| Catalog # | ABIN632130 |
| Price | |
| Order / More Info | ARP3 Actin-Related Protein 3 Homolog B (Yeast) (ACTR3B) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |