| Edit |   |
|---|
| Antigenic Specificity | ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The specific function of this gene has not yet been determined, however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. |
|---|
| Immunogen | ACTR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE |
|---|
| Other Names | Tb03.27C5.490|DDBDRAFT_0218534|DDBDRAFT_0219936|DDB_0218534|DDB_0219936|actr3|MGC53892|ACTR3|ARP3|ACTIN-RELATED PROTEIN 3|ARABIDOPSIS THALIANA ACTIN-RELATED PROTEIN 3|ATARP3|DISTORTED TRICHOMES 1|F3F19.20|F3F19_20|1200003A09Rik|Arp3 |
|---|
| Gene, Accession # | Gene ID: 10096 |
|---|
| Catalog # | ABIN631909 |
|---|
| Price | |
|---|
| Order / More Info | ARP3 Actin-Related Protein 3 Homolog (Yeast) (ACTR3) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|