| Edit |   |
| Antigenic Specificity | GDP-Mannose Pyrophosphorylase B (GMPPB) (C-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | GMPPB is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. |
| Immunogen | GMPPB antibody was raised using the C terminal of GMPPB corresponding to a region with amino acids RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM |
| Other Names | gmppl|zgc:92026|gmppb|GMPPB|MDDGA14|MDDGB14|MDDGC14|AI317178|E430010H19|RGD1560458 |
| Gene, Accession # | Gene ID: 29925,331026,363145 |
| Catalog # | ABIN629777 |
| Price | |
| Order / More Info | GDP-Mannose Pyrophosphorylase B (GMPPB) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |