| Edit |   |
| Antigenic Specificity | Carboxylesterase 5A (CES5A) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. |
| Immunogen | Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP |
| Other Names | CES7|Bmae47|cce-5a|Bmcce-5a|jhe-lp5l|jhe-lp5s|CAUXIN|CES4C1|CES5|1700081L16Rik|1700122C07Rik|BB081581|Ces7|Gm503|cauxin|Ces5|LOC445455 |
| Gene, Accession # | Gene ID: 221223 |
| Catalog # | ABIN634041 |
| Price | |
| Order / More Info | Carboxylesterase 5A (CES5A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |