| Edit |   |
| Antigenic Specificity | Lysine (K)-Specific Demethylase 4B (KDM4B) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes. |
| Immunogen | JMJD2 B antibody was raised using the middle region of JMJD2 corresponding to a region with amino acids DQDRKWFETWDEEVVGTFSNWGFEDDGTDKDTNFHVALENVDTTMKVHIK |
| Other Names | KDM4B|JMJD2B|jmjd2b|si:ch211-124a3.4|TDRD14B|4732474L06Rik|Jmjd2b|mKIAA0876 |
| Gene, Accession # | Gene ID: 23030 |
| Catalog # | ABIN631296 |
| Price | |
| Order / More Info | Lysine (K)-Specific Demethylase 4B (KDM4B) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |