| Edit |   |
| Antigenic Specificity | PNMA6A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 55%, rat 49%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human PNMA6A polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: IPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELDREVN |
| Other Names | paraneoplastic Ma antigen family member 6A, MGC15827, PNMA6C |
| Gene, Accession # | Gene ID: 84968, UniProt: P0CW24, ENSG00000235961 |
| Catalog # | HPA052115 |
| Price | |
| Order / More Info | PNMA6A Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |