| Edit |   |
| Antigenic Specificity | SPINK6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 78%, rat 78%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human SPINK6 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKH |
| Other Names | serine peptidase inhibitor, Kazal type 6, BUSI2, MGC21394, UNQ844 |
| Gene, Accession # | Gene ID: 404203, UniProt: Q6UWN8, ENSG00000178172 |
| Catalog # | HPA011039 |
| Price | |
| Order / More Info | SPINK6 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |