| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | HMG4/HMGB3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat (predicted: hamster) |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for High mobility group protein B3(HMGB3) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants. |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences. |
| Other Names | High mobility group protein B3;High mobility group protein 2a;HMG-2a;High mobility group protein 4;HMG-4;HMGB3;HMG2A, HMG4; |
| Gene, Accession # | HMGB3, UniProt: O15347 |
| Catalog # | PB9633 |
| Price | |
| Order / More Info | HMG4/HMGB3 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|