| Edit |   |
| Antigenic Specificity | Epsin 2 (EPN2) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | EPN2 is a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. |
| Immunogen | Epsin 2 antibody was raised using the middle region of EPN2 corresponding to a region with amino acids DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN |
| Other Names | CG13853|CG13854|CG31170|CG31285|CG42250|Dmel\\CG42250|Dmel_CG31170|Dmel_CG31285|Epsin|LqfR|XII-10|epsin|epsin-like|epsin02|epsinR|l(3)03685|l(3)A9|l(3)SG62|l(3)XII-10|l(3)dsl-9|l(3)dsl9|EHB21|9530051D10Rik|AA536924|Ibp2|epsin-2 |
| Gene, Accession # | Gene ID: 22905,13855,60443 |
| Catalog # | ABIN631154 |
| Price | |
| Order / More Info | Epsin 2 (EPN2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |