| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Ribosomal Protein, Large, P0 (RPLP0) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, dog |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. |
| Immunogen | RPLP0 antibody was raised using the middle region of RPLP0 corresponding to a region with amino acids PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY |
| Other Names | AP3|Ap3|Ape|CG7490|Dmel\\CG7490|LP0|P0|P35|PO|RLA0|RPL P0|RpP0|RpPO|Rplp0|l(3)0154|l(3)01544|p0|RPLP0|arp|fa56b12|fb04a12|wu:fa56b12|wu:fb15a08|wu:fk48c12|arbp|l10e|lp0|prlp0|rpp0|L10E|PRLP0|RPP0|36B4|Arbp|ARBP |
| Gene, Accession # | Gene ID: 6175,609159 |
| Catalog # | ABIN630015 |
| Price | |
| Order / More Info | Ribosomal Protein, Large, P0 (RPLP0) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|