If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins.
Immunogen
RPLP0 antibody was raised using the N terminal of RPLP0 corresponding to a region with amino acids TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT