| Edit |   |
|---|
| Antigenic Specificity | Ribosomal Protein L10a (RPL10A) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm. |
|---|
| Immunogen | RPL10 A antibody was raised using the middle region of RPL10 corresponding to a region with amino acids YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK |
|---|
| Other Names | Csa-19|L10A|NEDD6|CsA-19|Nedd6|wu:fb94f08|zgc:73082|zgc:86881 |
|---|
| Gene, Accession # | Gene ID: 4736 |
|---|
| Catalog # | ABIN631783 |
|---|
| Price | |
|---|
| Order / More Info | Ribosomal Protein L10a (RPL10A) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|