| Edit |   |
| Antigenic Specificity | Ribosomal Protein L13a (RPL13A) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. |
| Immunogen | RPL13 A antibody was raised using the middle region of RPL13 corresponding to a region with amino acids HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY |
| Other Names | CG1475|Dmel\\CG1475|L13A|L13a2|M(3)83B|Rp L13A|anon-EST:Posey125|anon-EST:fe1A5|bs25f04.y1|cg1475|MGC54018|GB16111|DDBDRAFT_0217704|DDBDRAFT_0231192|DDB_0217704|DDB_0231192|TSTA1|hm:zehp0384|wu:fa95e06|wu:fb08g07|wu:fd05d08|1810026N22Rik|Tstap198-7|tum-antigen |
| Gene, Accession # | Gene ID: 23521 |
| Catalog # | ABIN631597 |
| Price | |
| Order / More Info | Ribosomal Protein L13a (RPL13A) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |