| Edit |   |
| Antigenic Specificity | Ribosomal Protein L37a (RPL37A) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. |
| Immunogen | RPL37 A antibody was raised using the middle region of RPL37 corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD |
| Other Names | BcDNA:RE23595|BcDNA:RH41593|CG5827|DmL37a|Dmel\\CG5827|L37A|M(2)25C|M(2)S1|RpL37a|l(2)25Cb|CG9091|Dmel\\CG9091|RpL37|RpL37A|RGD1561181|Rpl37a |
| Gene, Accession # | Gene ID: 6168,19981,363248 |
| Catalog # | ABIN631577 |
| Price | |
| Order / More Info | Ribosomal Protein L37a (RPL37A) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |