| Edit |   |
|---|
| Antigenic Specificity | UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | UGT2A3 is a single-pass type I membrane proteinPotential. It belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. |
|---|
| Immunogen | UGT2 A3 antibody was raised using the N terminal of μgT2 3 corresponding to a region with amino acids NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN |
|---|
| Other Names | UGT2A1|zgc:112491|2010321J07Rik|RGD1308444|Ugt2a3 |
|---|
| Gene, Accession # | Gene ID: 79799 |
|---|
| Catalog # | ABIN636014 |
|---|
| Price | |
|---|
| Order / More Info | UDP Glucuronosyltransferase 2 Family, Polypeptide A3 (UGT2A3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|