| Edit |   |
|---|
| Antigenic Specificity | Exoribonuclease 1 (ERI1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | THEX1 contains 1 SAP domain and 1 exonuclease domain. It is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). |
|---|
| Immunogen | THEX1 antibody was raised using the N terminal of theX1 corresponding to a region with amino acids EPPRPSPEETQQCKFDGQETKGSKFITSSASDFSDPVYKEIAITNGCINR |
|---|
| Other Names | THEX1|thex1|zgc:110635|hexo|Eri-1|3'HEXO|HEXO|3'hexo|3110010F15Rik|Thex1|eri-1|RGD1308378 |
|---|
| Gene, Accession # | Gene ID: 90459 |
|---|
| Catalog # | ABIN633196 |
|---|
| Price | |
|---|
| Order / More Info | Exoribonuclease 1 (ERI1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|