| Edit |   |
| Antigenic Specificity | V-Set and Immunoglobulin Domain Containing 1 (VSIG1) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of VSIG1 protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | VSIG1 antibody was raised using the N terminal of VSIG1 corresponding to a region with amino acids SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN |
| Other Names | VSIG1|vsig1|CHT1|1700062D20Rik|GPA34|dJ889N15.1|4930405J24Rik|ctx|ctx-A|gpa34 |
| Gene, Accession # | Gene ID: 340547 |
| Catalog # | ABIN635590 |
| Price | |
| Order / More Info | V-Set and Immunoglobulin Domain Containing 1 (VSIG1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |