| Edit |   |
| Antigenic Specificity | Dihydrouridine Synthase 1-Like (S. Cerevisiae) (DUS1L) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs. |
| Immunogen | DUS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF |
| Other Names | zgc:63748|wu:fb71f06|DUS1|PP3111|1110032N12Rik|Dus1l|x85 |
| Gene, Accession # | Gene ID: 64118 |
| Catalog # | ABIN632587 |
| Price | |
| Order / More Info | Dihydrouridine Synthase 1-Like (S. Cerevisiae) (DUS1L) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |