| Edit |   |
| Antigenic Specificity | Endophilin-A1 (SH3G2) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature. |
| Immunogen | SH3 GL2 antibody was raised using the middle region of SH3 L2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD |
| Other Names | CNSA2|EEN-B1|SH3D2A|SH3P4|9530001L19Rik|AI120490|AW555077|B930049H17Rik|SH3PA|Sh3d2a|Sh3p4 |
| Gene, Accession # | Gene ID: 6456,20404 |
| Catalog # | ABIN633831 |
| Price | |
| Order / More Info | Endophilin-A1 (SH3G2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |