| Edit |   |
| Antigenic Specificity | Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CACNB2 is a member of the ion-channel geneuperfamily. Described as a Lambert-Eaton myasthenic syndrome (LEMS) antigen in humans, this gene is found close to a region that undergoes chromosome rearrangements in small cell lung cancer, which occurs in association with LEMS. |
| Immunogen | CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids DYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRT |
| Other Names | Cacnb2|CACNB2|CACNLB2|CAVB2|MYSB|CAB2|AW060387|Cavbeta2|Cchb2|Cacnlb2 |
| Gene, Accession # | Gene ID: 783 |
| Catalog # | ABIN630074 |
| Price | |
| Order / More Info | Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |