| Edit |   |
| Antigenic Specificity | Calcium Modulating Ligand (CAMLG) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. CAMLG functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. |
| Immunogen | CAMLG antibody was raised using the N terminal of CAMLG corresponding to a region with amino acids LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRV |
| Other Names | MGC53900|CAML|AI385748|Camlg|Caml |
| Gene, Accession # | Gene ID: 819 |
| Catalog # | ABIN630925 |
| Price | |
| Order / More Info | Calcium Modulating Ligand (CAMLG) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |