| Edit |   |
| Antigenic Specificity | DPH1 Homolog (S. Cerevisiae) (DPH1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. |
| Immunogen | DPH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NQIPPEILKNPQLQAAIRVLPSNYNFEIPKTIWRIQQAQAKKVALQMPEG |
| Other Names | DPH1|DPH1-OVCA2|dph1-ovca2|dph2l|dph2l1|ovca1|DPH2L|DPH2L1|OVCA1|zgc:110702|2310011M22Rik|4930488F09Rik|AW551873|Dph2l1|Ovca1|RGD1562694 |
| Gene, Accession # | Gene ID: 1801 |
| Catalog # | ABIN632548 |
| Price | |
| Order / More Info | DPH1 Homolog (S. Cerevisiae) (DPH1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |