| Edit |   |
|---|
| Antigenic Specificity | DPH2 Homolog (S. Cerevisiae) (DPH2) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. This gene is one of two human genes similar to the yeast gene dph2. |
|---|
| Immunogen | DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAH |
|---|
| Other Names | DPH2L2|9130020C19Rik|AI467389|Dph2l2|id:ibd5058|zgc:162269 |
|---|
| Gene, Accession # | Gene ID: 1802 |
|---|
| Catalog # | ABIN631965 |
|---|
| Price | |
|---|
| Order / More Info | DPH2 Homolog (S. Cerevisiae) (DPH2) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|