| Edit |   |
|---|
| Antigenic Specificity | Dynein, Cytoplasmic 1, Intermediate Chain 2 (DYNC1I2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DYNC1I2 acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. Involved in membrane-transport, such as Golgi apparatus, late endosomes and lysosomes. |
|---|
| Immunogen | DYNC1 I2 antibody was raised using the N terminal of DYNC1 2 corresponding to a region with amino acids VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDH |
|---|
| Other Names | dnci2|dncic1|ic2|dync1i2|im:7147021|zgc:153318|3110079H08Rik|AW554389|Dncic2|Dnci2|DNCI2|IC2 |
|---|
| Gene, Accession # | Gene ID: 1781 |
|---|
| Catalog # | ABIN633070 |
|---|
| Price | |
|---|
| Order / More Info | Dynein, Cytoplasmic 1, Intermediate Chain 2 (DYNC1I2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|