| Edit |   |
|---|
| Antigenic Specificity | delta-Like 1 (DLL1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. |
|---|
| Immunogen | DLL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP |
|---|
| Other Names | X-delta-1|XDelta1|Xdelta-1|delta|delta-1|delta1|x-delta|DLL1|CRLM2|Ly114|Tpte2|Tslpr|DELTA1|DL1|Delta|Delta1 |
|---|
| Gene, Accession # | Gene ID: 28514,13388,84010 |
|---|
| Catalog # | ABIN634696 |
|---|
| Price | |
|---|
| Order / More Info | delta-Like 1 (DLL1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|